My breakthrough came when I decided to treat a slight headache by standing barefoot outside on the ground. Years later I had the bad luck to contract a furious rash from a parasite lurking on that same ground. The remedy? The only remedy which worked was a paste of simple yellow sulphur bought for a few dollars from an equine supply store.
Yep. Some ground up rock, a component of earth, did what no pharmaceutical could do. Just as a tooth powder with freshly ground cloves added to clay and salt cured an abcess nothing else would shift.
We are already "back to earth". We're there. We just need to know it.
Kevin, I've found this old study from 2016, claiming that Rubella vaccine had fetal DNA residual, at 150 ng. Hepatitis A and chickenpox vaccine did, as well. They said vaccines made from HEK293 line ALL have the risk of causing autoimmunity, autism, and genome integration.
Also in Swiss, experiments not only with Psilocybin and other mushrooms but also with LSD under guidance and with minimum doses for major depression. No big news in homeopathy for decades we use the Solanaceae with outstanding results.
that 'they' are sure there won't be any need to passwords mid summer 2025... That strange remark about 'being pretty sure somebody is NOT synthetically created' caught my ear. WHAT???
After mentioning it on other substack, somebody answered that's just 'speech recognition' which will be applied on all digital devices.. Well today came this, from NPR:
with deep involvement of ROckefeller University. FOXP2 and NOVA1 genes, present only in the modern man (NOT IN quote 'extinct human species, the Neanderthals and Denisovans') are doing the trick in mice: making ultrasonic chirps.... Can Iphones detect ultrasound??? Maybe chasing some lost Denisovan here...Well, quick BLAST search comparing the isoform4 P51513 with Spike2020:
and many,many more fragments, some spanning <100 amino acids. Is that all a coincidence??? With every singe aromatic amino acid contributing to neurotransmission one could maybe argue that something is fishy here, and it is not only a small fish..??
My breakthrough came when I decided to treat a slight headache by standing barefoot outside on the ground. Years later I had the bad luck to contract a furious rash from a parasite lurking on that same ground. The remedy? The only remedy which worked was a paste of simple yellow sulphur bought for a few dollars from an equine supply store.
Yep. Some ground up rock, a component of earth, did what no pharmaceutical could do. Just as a tooth powder with freshly ground cloves added to clay and salt cured an abcess nothing else would shift.
We are already "back to earth". We're there. We just need to know it.
Well said … “ conveyor belt of crime “ …. Yes absolutely disgusting. 🤬
Can SV40 promoter/enhancer be banned as well as red dye?
Kevin, I've found this old study from 2016, claiming that Rubella vaccine had fetal DNA residual, at 150 ng. Hepatitis A and chickenpox vaccine did, as well. They said vaccines made from HEK293 line ALL have the risk of causing autoimmunity, autism, and genome integration.
https://cienciaysaludnatural.com/wp-content/uploads/2019/04/Insertional-Mutagenesis.pdf
1) I wonder if the study was true, or just a fake paper?
2) Can you do the examination for other current vaccines, to see if they really have excess DNA, and if they really are a danger to human health?
Also in Swiss, experiments not only with Psilocybin and other mushrooms but also with LSD under guidance and with minimum doses for major depression. No big news in homeopathy for decades we use the Solanaceae with outstanding results.
Has everyone seen Jeffery Sacks speech at the Munich Security Conference?
US foreign policy for the last thirty years. The truth.
Short version with transcript.
https://johnmenadue.com/jeffrey-sachs-explosive-address-at-the-eu-parliament-sends-shockwaves-across-europe/
Long version with transcript.
https://newsparadigm.substack.com/p/jeffrey-sachs-heroic-speech-at-geopolitics
What you said in the video is confirmed by this preprint here....
Nasty results which validate those who chose not to take the predrug:
https://www.medrxiv.org/content/10.1101/2025.02.18.25322379v1.full.pdf
Also this one re potential fertility:
https://pdf.sciencedirectassets.com/315508/AIP/1-s2.0-S2162253125000435/main.pdf
https://www.whitehouse.gov/presidential-actions/2025/02/ensuring-accountability-for-all-agencies/
are we being slowly closed in a black box???
THank You for the interesting interview!
In regard to the elites..., Ellison mentioned, just one minute,after ~1:00 at
https://x.com/Donuncutschweiz/status/1890065645909442747
that 'they' are sure there won't be any need to passwords mid summer 2025... That strange remark about 'being pretty sure somebody is NOT synthetically created' caught my ear. WHAT???
After mentioning it on other substack, somebody answered that's just 'speech recognition' which will be applied on all digital devices.. Well today came this, from NPR:
https://www.npr.org/2025/02/18/nx-s1-5296947/human-gene-variant-alters-the-voices-of-mice
with deep involvement of ROckefeller University. FOXP2 and NOVA1 genes, present only in the modern man (NOT IN quote 'extinct human species, the Neanderthals and Denisovans') are doing the trick in mice: making ultrasonic chirps.... Can Iphones detect ultrasound??? Maybe chasing some lost Denisovan here...Well, quick BLAST search comparing the isoform4 P51513 with Spike2020:
Query 487 LITQRI----TY--EQGVRAA 501 <<<=NOVA1 = P51513
______________LIT R+ TY +Q +RAA
Sbjct 996 LITGRLQSLQTYVTQQLIRAA 1016 <<<=SPIKE2020
Query 361 LLATYASEASASGSTAGGTAG--TFALGSLAAAT 392
LLA + S + S++G TAG + G L T
Sbjct 241 LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRT 274
Query 474 ITGTPAATQAAQYLITQRITYEQGVRA-AN 502
ITG Q+ Q +TQ++ +RA AN
Sbjct 997 ITG---RLQSLQTYVTQQLIRAAEIRASAN 1023
Query 281 TAAAAAGLLGH 291
TA AAA G+
Sbjct 259 TAGAAAYYVGY 269
Query 388 LAAATAATNGY-FGAASPL 405
L A T T G+ FGA + L
Sbjct 877 LLAGTI-TSGWTFGAGAAL 894
and many,many more fragments, some spanning <100 amino acids. Is that all a coincidence??? With every singe aromatic amino acid contributing to neurotransmission one could maybe argue that something is fishy here, and it is not only a small fish..??